Kingdom Related Words

examples: winterunderstandingcloud

Here are some words that are associated with kingdom: monarchy, land, king, realm, queen, prince, monarch, royal, country, ruler, duchy, domain, empire, sovereign, britain, imperial, crown, kingship, herod, pharaoh, nebuchadnezzar, sultan, queendom, constitutional monarchy, crown prince, emir, republic, throne, absolute monarchy, attila. You can get the definitions of these kingdom related words by clicking on them. Also check out describing words for kingdom and find more words related to kingdom using ReverseDictionary.org

Words Related to kingdom

Below is a list of words related to kingdom. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to kingdom:

monarchy land king realm queen prince monarch royal country ruler duchy domain empire sovereign britain imperial crown kingship herod pharaoh nebuchadnezzar sultan queendom constitutional monarchy crown prince emir republic throne absolute monarchy attila czar ahab emperor mithridates athelstan gustavus monarchical pyrrhus alaric macbeth royalist gilgamesh kingly alfred clovis croesus hammurabi ferdinand archduke majesty royalty shah princely edwin hm
related words continue after advertisement
empress regal area group field orbit arena grouping animalia state israel demesne fungi sphere numidia phylum uk taxon roy saul royally carolingian princess quatorze kaiser intendant queenly solomon princedom regnum ducal kingdomed queenie david khan kingric nobleman hezekiah kingmaker infanta chessman royalism monarchal infante regent pfalzgraf antiking overking gordius kingling kingian regency regius archduchess sovereignty jeroboam diadem dragonking kinglike foreking superregal kingless underking royalet merking stuart principality regally u.k. prokayotae monera plantae protoctista lotusland edward prial preeminent viceroy nonroyalty princeling melchizedek luft caesar wessex shahanshah queenlike shogi kingmaking queenish aristocrat cleopatra unqueen queenless tiara coronation kingslayer parr gesith territories merqueen howard judah rulers coronet queenship potentate queeny queencraft castle requeen coronate colony queenhood discrown established india territory dynast conquered part highking century kingdoms lands existed invaded persia persian western conquest bohemia latter became ireland prussia recognised annexed ottoman of neighbouring originated ii name northern egypt europe indian which isles in subcontinent chesspiece eastern occupied centuries habsburg invasion created granted thus region the namely british colonies rule denmark oldest ruled incorporated order descendants scotland recognized independence scandinavia burma ragman bengal mongol frankish ancient nation dynasty africa canada parts known vassal itself united 20th poland originating turks bhutan sovereignize moneyage kinghood speech from throne grand duke non royal king of german your majesty live in castle ruler of country his majesty king of france rule country fungus kingdom taxonomic group lotus land kingdom prokaryotae kingdom fungi kingdom monera kingdom animalia taxonomic category animal kingdom mineral kingdom plant kingdom united kingdom united kingdom of great britain and northern ireland great britain kingdom plantae kingdom protoctista queen dowager prince of wale queen of england queen regnant her majesty throne room royal family queen consort queen it 1947 marie antoinette chess game crown princess lead country 4 king 3 king 2 king 1 king 2 samuel 1 samuel chess piece monarchical hero bee hive king of england queen pawn female aristocrat earl marshal naked mole rat royal marriage face card head of state scandinavian defence partial pin crown jewel scotch game king's pawn game smother mate play checker absolute pin sultanate emirate nejd davidic hashemite rehoboam hyksos najd palace archipelago sennacherib babylonia parthia khalifa artaxerxes visigothic pharoah uther imamate hejaz fatimid vicegerent divinities highness kabaka ahasuerus seleucid socotra caliph harems midianites prophet island khans israelites assyria boabdil chiefdom lawgiver deity god arabian edomites senussi handmaid djinn aristocracies uruk nizam hittites majesties judaea phrygia chess rook sheikhdom hofuf nabataean houbara jinns sheikdom yhvh jidda riyal hadramaut ishmaelites mutawa polytheist midianite shaytan patriarchies taxonomy arabian peninsula rameses ii trucial states persian empire nebuchadnezzar ii manchu dynasty saudi arabia ramesses ii empty quarter

Popular Searches

Words Related to kingdom

As you've probably noticed, words related to "kingdom" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "kingdom" are: monarchy, land, king, realm, and queen. There are 394 other words that are related to or similar to kingdom listed above. Hopefully the generated list of kingdom related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like kingdom may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is kingdom?

Also check out kingdom words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of kingdom themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr