Dancers Related Words

examples: winterunderstandingcloud

Here are some words that are associated with dancers: choreography, ballet, waltz, modern dance, performer, choreographer, opera, ballroom dance, tango, performance, rhythm, folk dance, circle dance, tap dance, virtuoso, ballerina, showgirl, singer, hoofer, massine, ulanova, actor, artist, stripper, ted shawn, ecstasy, kinesiology, ballet dancer, belly dancer, exotic dancer. You can get the definitions of these dancers related words by clicking on them. Also check out describing words for dancers and find more words related to dancers using ReverseDictionary.org

Words Related to dancers

Below is a list of words related to dancers. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to dancers:

choreography ballet waltz modern dance performer choreographer opera ballroom dance tango performance rhythm folk dance circle dance tap dance virtuoso ballerina showgirl singer hoofer massine ulanova actor artist stripper ted shawn ecstasy kinesiology ballet dancer belly dancer exotic dancer chorus girl maria tallchief dame margot fonteyn tamara karsavina folk dancer moira shearer entertainer troupe violinist pianist musician cabaret actress stage cellist soprano nijinsky
related words continue after advertisement
gymnast singers diva burlesque skater soloist flamenco magician narrative comedienne vocalist flutist kathak artiste percussionist flautist concert dance social dance ceremonial dance erotic dance classical ballet classical indian dance isadora duncan ruth st. denis group dance square dance martha graham pas de deux natyashastra disco salsa mime meter folklore lindy hop aesthetic symbolism culture terpsichorean play ritual gymnastics cheerleading stepper tapper alonso astaire balanchine baryshnikov cunningham duncan graham jamison kelly mitchell montez nureyev pavlova rogers salome shawn shearer tharp tudor vestris individual mortal person somebody someone soul society polka emotion story exercise song archeology india chorine dancing-master kachina fonteyn karsavina markova tallchief raver waltzer rainforest music plato professional dancer social dancer aristotle plutarch lucian sport bible talmud neolithic dancers dancing dance bollywood jig singing performing art duet art form pattern songwriter vaudeville horos musical conductor danse participation dance actresses pottery operatic starred onstage pulse duo ensemble actors accompanist stuntman tempo comedian competitive dance legendary comedy filmmaker accent composer rest war dance piano hop sacred dance pop performers lover stylist liturgical dance trio solo martial arts romantic stone girl aspiring partner mudras blonde wrestler superstar violist dances girlfriend starring renaissance musicians impresario figure skating drama young bharatanatyam famed woman acclaimed waitress synchronised swimming swimmer performed performing bandleader favourite playwright performs blond racer clarinetist instructor sings egypt mime artist dance costumes theatrical scenery ballet master ballet mistress exotic belly dancer dance master nautch girl performing artist tap dancer taxi dancer alicia alonso fred astaire george balanchine mikhail baryshnikov merce cunningham agnes de mille agnes george de mille de mille judith jamison eugene curran kelly gene kelly dame alicia markova lilian alicia marks leonid fyodorovich myasin leonide fedorovitch massine arthur mitchell lola montez marie dolores eliza rosanna gilbert vaslav nijinsky waslaw nijinsky rudolf nureyev anna pavlova ginger rogers virginia katherine mcmath virginia mcmath ruth saint denis saint denis st. denis twyla tharp antony tudor galina sergeevna ulanova galina ulanova gaetan vestris clog dancer dancing partner interpretive dance carol rumba striptease foxtrot kathakali juggler instrumentalist danseur danseuse contestant chanteuse mambo songstress thespian fiddler greece minuet musical theatre line dance go-go stand-up partner dance social interaction corps de ballet trance solo dance rave culture trapeze electronic dance music free dance tala spirit bol rock shelters of bhimbetka kabuki ancient egypt noh altered state of consciousness chorographer aerialist contortionist lambada danceress thiasus ropedancer rigadoon voguing clarinettist rhumba balletomane sculptress cachucha kalahari desert rockette twirler greek dance sex indian classical dance grief andantino fertility missionaries colonialist oracle bones lüshi chunqiu common era bharata muni causality odissi contemporary dance pakistan historical dance bhangra traditional dance sikh time signature ayurvedic tango music jidaimono sewamono shosagoto musical genre baroque music baroque dance classical music era polyrhythm handkerchief caller maypole symmetry in biology abhinaya duple and quadruple meter triple metre odisha music of southeastern europe guglielmo ebreo da pesaro mechthild of magdeburg thoinot arbeau lincoln kirstein percy scholes émile jaques-dalcroze dalcroze eurhythmics common metre dabke prima ballerina baton twirler paso doble female impersonator belly dancing drag queen ballroom dancing roller skater figure skater ballet company danseur noble fox trot jazz musician coloratura soprano beauty queen interpretative dance tamzara paris samba 2 and 3 part inventions adams violin concerto dramatic structure céilidh ballet blanc danse des petits cygnes swan lake character dance romantic nationalism rudolf laban merengue igor stravinsky the rite of spring plena eurhythmics cumbia bachata carnival capoeira pelvis humanities estonia arabesque jive harlequin popping splits indonesia dvd eurythmy social dances structural cohesion hiplet punjab region cueca dances of sri lanka jarabe psychological manipulation joropo classical dances of sri lanka marinera middle eastern dance ethnochoreology dancesport hip-hop jitterbug columbina neo-pagan breakdance assyrian folk dance kurdish dance armenian dance turkish dance walking stick jazz dance swing dance new world louis xiv 20th century concert dance loie fuller rock and roll mary wigman le sacre du printemps emile jaques-dalcroze marie rambert rudolf steiner latin america marie steiner-von sivers doris humphrey african american dance hip hop dance hip hop the arts bachelor of arts academic degree dance notation dance therapy american guild of musical artists screen actors guild actors' equity association dance school dance on television irish stepdance dance partnering acro dance front aerial juke joint gumboot dance copenhagen, denmark hip-hop dance pole dancer fire dance bolshoi theatre pagar alam sequence dance street dance music video

Popular Searches

Words Related to dancers

As you've probably noticed, words related to "dancers" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "dancers" are: choreography, ballet, waltz, modern dance, and performer. There are 496 other words that are related to or similar to dancers listed above. Hopefully the generated list of dancers related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like dancers may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is dancers?

Also check out dancers words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of dancers themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr