Deft Related Words

examples: winterunderstandingcloud

Here are some words that are associated with deft: dexterous, dextrous, skillful, adroit, skilful, snappy, nimble, masterful, clever, incisive, superb, inventive, clumsy, masterly, honed, unorthodox, brilliant, canny, shrewd, ingenious, virtuosic, acrobatic, droll, dazzling, crafty, witty, effortless, cunning, subtle, gutsy. You can get the definitions of these deft related words by clicking on them. Also check out describing words for deft and find more words related to deft using ReverseDictionary.org

Words Related to deft

Below is a list of words related to deft. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to deft:

dexterous dextrous skillful adroit skilful snappy nimble masterful clever incisive superb inventive clumsy masterly honed unorthodox brilliant canny shrewd ingenious virtuosic acrobatic droll dazzling crafty witty effortless cunning subtle gutsy wristy graceful minesweeper admirable-class expedient footwork bravura meaningly deftly lob dribbling unmeaning meany mean knack volley nuance average imaginative backhand mediocrity meaningful volleys angled volleying wherewithal
related words continue after advertisement
moderately medial stingy deadpan median aplomb mediator rhetorical painterly lunging wickedly baseline forehand mediation comedic coolly straightforward meanly miserly disingenuous synonymy expertly meaningless significative piteous diction finesse jabs significance signify mediocre deflecting shabby storytelling wordplay punchy repartee rasping virtuosity plodding deflection fluffed touches percussive overtone pacing twists spirited taut trickery compositional persuasive staccato wit intuitive workmanlike mediate inventiveness brushstrokes connotation averageable quomodo miserliness meaningness signification mid meaninglessness miser discreditable synonymous intermean lobs meanie meanless sleight meanling penurious medially nonsignificance unaveraged averageness backheel semantics u.s. navy averagely equivocation subaverage mede intermediate polysemous topspin middle polysemic medium shitass crosscourt shotmaking cruel left-foot groundstrokes saipan lawyerly camerawork forehands denote referent bemean connote midst backhanded hard-hitting backhands brushwork wretched draftsmanship ignoble forkball resourceful pacific ocean intension stream-of-consciousness autotelic freekick satiric meanness mismean unexceptional promptly despicable heterotelic quick beastliness demean statistic okinawa selfish denotation swiftly statistical centroid swift midmost mode briskly expeditious grotty speedy undefined squib speedily rapid quickly unkind skilled fast gemeinschaft quickness fierce symbolization swiftness tampa shipbuilding inane dint douchebag pacey mediumly jackslave denotative logomach illocution phonestheme agential pointlessness scabbily imell pelter ordinariness hean tampa, florida autotelism fast track neosemanticism behight fuzzword naff quicksmart japan intentionalism ultraquick weeniehead sensemaking polyseme pejoration cardiotocography antonymous rapidness megilp bioroid speediness rhyparography polysemy quadratic mean ultrarapid abstinent arithmetic mean contraharmonic mean norfolk, virginia alacritous geometric mean harmonic mean artful astute sublime sly nifty adept uncanny instinctive preternatural forceful exquisite mesmeric unerring wily delightful peerless nerveless faultless steely maladroit beguiling mesmerizing delicate mercurial perceptive impudent scintillating silky splendid cleanly nuanced marvelous flawless tactful thunderous impeccable wry impish audacious silken irrepressible inimitable gestural eloquent sharp judicious cheeky terrific trenchant fisted savvy crisp daring insouciant artless felicitous refactor andantino honshū average bear root mean square san diego, california grade point average open sesame double entendre ostensive definition pearl harbor dictionary definition standard deviation drive at standard error deftest balletic waspish rangy metronomic defter zestful nimblest spellbinding classily unshowy unmannered puckish mean time average joe so so above average in between be on about middle way instrumental case take mean philippines semantic relation shanty town ephemeris time get at what's up dangle modifier nonparametric statistic middle voice use mention distinction fast and furious phonetic symbolism fast pace in flash sasebo, nagasaki u.s. west coast san pedro, california subic bay republic of china taiwan navy public domain dictionary of american naval fighting ships

Popular Searches

Words Related to deft

As you've probably noticed, words related to "deft" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "deft" are: dexterous, dextrous, skillful, adroit, and skilful. There are 376 other words that are related to or similar to deft listed above. Hopefully the generated list of deft related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like deft may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is deft?

Also check out deft words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of deft themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr