Semantic Related Words

examples: winterunderstandingcloud

Here are some words that are associated with semantic: syntax, sign, semiotics, word, semantics, connotation, denotation, symbol, synonym, parsing, linguistics, syntactic, spatial, perceptual, probabilistic, phonological, pragmatics, lexical, metadata, relational, computational, linguistic, etymological, typological, reference, grammatical, denotative, contextual, algorithmic, associative. You can get the definitions of these semantic related words by clicking on them. Also check out describing words for semantic and find more words related to semantic using ReverseDictionary.org

Words Related to semantic

Below is a list of words related to semantic. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to semantic:

syntax sign semiotics word semantics connotation denotation symbol synonym parsing linguistics syntactic spatial perceptual probabilistic phonological pragmatics lexical metadata relational computational linguistic etymological typological reference grammatical denotative contextual algorithmic associative mathematical syntactical terminological philosophy of language meaning phrase agent synonymy signification community mean meaningly meany meaningful unmeaning nuance overtone synonymous
related words continue after advertisement
semasiology etymology significative significance signify referent meanly mediocrity philology constructs polysemic communication wherewithal median medial mediator meaningless polysemous average connote synchronization proxemics discreditable logomach lexicology shabby quomodo mediation piteous meaningness binary fuzzword meanie meanless nonlinear nonsignificance miserliness discourse morphological phonestheme polyseme ontology linear incompatibilities intermediate stingy meaninglessness compatibility algorithms intermean dynamical interfaces mediocre computation meanling microlinguistics neosemanticism compound pejoration discrete predictive equivocation stochastic miser graphical mediawiki paradigms miserly functionality encoding homonym mappings interpersonal mediate illocution ancient greek annotation parallelism equations coding incompatibility relatedness disingenuous typology indexing clustering meanings interpolation neural ignoble mid sociocultural denote modes html numerical complexity caching schema antonym antimetathesis beastliness asymmetry heterogeneity parameters differentiation inhomogeneous definitions intension biases bemean functionalities polysemy generalized retrieval regression interlacing authentication implementations algebraic autotelic interface sequential quadratic contexts rdf visualization segmentation moderately conceptual paraphrase shitass adaptive bayesian antiphrasis herbalist symbolization heterophemy signifier heterotelic toneme demean non-linear mismean medium mede subaverage despicable statistic misconstruction middle medially statistical meanness averageness ambiguity averagely unaveraged verbalism undefined definition averageable international scientific vocabulary object-oriented penurious scabbily selfish imply paronymous real-world deft cruel wretched expletive grotty midst michel bréal hean autotelism kineme dint one-to-one verstehen domain-specific abject gemeinschaft higher-level mode jackslave formal semantics non-standard pointlessness contemptible end-user shoddy malicious subtext douchebag centroid versioning multi-dimensional pelter hypernym agential class-based antonymous ostensive definition behight dictionary definition hyponym bioroid meronymy refactor archetype metonymy disambiguator intentionalism naff holonymy unexceptional mediumly harmonic mean geometric mean contraharmonic mean weeniehead sensemaking lexicalize double entendre semantic relation multivocal arithmetic mean protoconversation quadratic mean deictic metaphor charactery rhyparography mesolabe imell cardiotocography aftergame logomachy surtext dangle modifier qualia neurosemantics use mention distinction root mean square open sesame lexical definition standard deviation drive at average bear standard error phonetic symbolism meta textual heuristic analytic ontological inferential declarative semiotic phonemic hypertext transitive phonetic intransitive iterative disjoint rhetorical orthographic prepositional epistemological expressible trigonometric unstructured epistemic bibliographic adverbial subjunctive descriptive federated arithmetical recursive methodological analytical posteriori wiki computable contrastive literal jesuitical referential extensible abstruse homophonic mean to end instrumental case mean time grade point average nyaya take mean semantic analysis ephemeris time jung what's up be on about average joe shanty town nonparametric statistic underspecification get at word sense semantic shift concrete term phrasal dialectical lexicographical hypermedia anthropic definitional combinatorial prosodic connotative sociolinguistic preconscious justificatory drupal deductive polysyllabic neurophysiological sophistic spatiotemporal assumptive legalistic onomatopoetic words vibration control distinction without difference middle way verifiability principle above average vyākaraṇa derrida truth condition existential nihilism fast track solar time in between by way of nietzsche thematic relation semantic differentiation middle voice discourse analysis richard montague lambda calculus alfred tarski language of thought montague grammar post-structuralists noam chomsky psychological nativism ontologies psychology semantic change mental rotation lexical unit cognitive linguistics jerry fodor ferdinand de saussure boolean logic fuzzy logic artificial intelligence search engine logical fallacy relational database spelling checker query language markup language mathematical notation computational linguistics generative grammar boolean algebra prepositional phrase deductive reasoning cognitive psychology hypertext markup language inductive reasoning ideasthesia wordnet generative lexicon james pustejovsky prototype theory eleanor rosch learning theory embodied philosophy linguistic relativity eskimo words for snow donald davidson computer science programming language formal semantics of programming languages semantic web world wide web resource description framework mathematical logic semantic network semantic memory episodic memory semantic data model directed graph latent semantic indexing support vector machines natural language processing neural networks predicate calculus web ontology language

Popular Searches

Words Related to semantic

As you've probably noticed, words related to "semantic" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "semantic" are: syntax, sign, semiotics, word, and semantics. There are 462 other words that are related to or similar to semantic listed above. Hopefully the generated list of semantic related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like semantic may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is semantic?

Also check out semantic words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of semantic themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr