Virus structure Related Words

examples: winter,  understanding,  cloud

Here are some words that are associated with virus structure: vector, archaea, immunity, genetic recombination, dna, rna, protein, capsid, lipid, aphid, chronic, viral replication, dmitri ivanovsky, tobacco mosaic virus, rabies, martinus beijerinck, optical microscope, genetic diversity, natural selection, bacteriophages, host specificity, foot-and-mouth disease, pandemic, reverse transcriptase, david baltimore, translation, pandoravirus, molecular biology, cell, organism. You can get the definitions of these virus structure related words by clicking on them. Also check out describing words for virus structure and find more words related to virus structure using ReverseDictionary.org

Words Related to virus structure

Below is a list of words related to virus structure. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to virus structure:

vector archaea immunity genetic recombination dna rna protein capsid lipid aphid chronic viral replication dmitri ivanovsky tobacco mosaic virus rabies martinus beijerinck optical microscope genetic diversity natural selection bacteriophages host specificity foot-and-mouth disease pandemic reverse transcriptase david baltimore translation pandoravirus molecular biology cell organism microorganism bacteria pathogen ecosystem apoptosis virology microbiology molecule helix icosahedron
related words continue after advertisement
evolution plasmid biologist life influenza gastroenteritis hiv vaccine poison sanskrit avestan microbiologist toxin antiviral drugs self-replication antigenic shift typhoid hematophagy cholera penicillin norovirus rotavirus lymph sars crystal neo-latin lipid bilayer fusion viral entry enzyme aphthovirus genes metabolism viral shedding infectivity chlamydia crystallization vaccinia infectious agent poliovirus morphology life forms salt tungsten virus species genome genetic material epstein–barr virus arterivirus pestivirus viral envelope retrovirus horizontal gene transfer sexual reproduction germline paleovirology plant sap rickettsia fecal–oral route infectious dose self-organisation sexually transmitted infection intron immune response nanometres mutate filovirus human papillomavirus infection viral hepatitis antiviral drug indo-european languages capsomere ancient greek attested language leucocytes john trevisa nucleoprotein bartholomeus anglicus cd4 poxviridae mass noun nucleoid classical latin pleomorphism mimivirus louis pasteur megavirus endocytosis mimiviridae charles chamberland pandoraviridae chamberland filter cellulose phycodnaviridae mollivirus germ theory of disease contagium vivum fluidum lysis wendell stanley friedrich loeffler polyomavirus frederick twort adenoviridae félix d'herelle hepadnaviridae agar plate positive-sense negative-sense antimicrobial resistance bacteriophage ebola virus disease ambisense ross granville harrison geminiviridae tissue culture arenavirus strain circoviridae ernest william goodpasture alice miles woodruff john franklin enders thomas huckle weller frederick robbins phylum hilary koprowski class jonas salk order polio vaccine family reassortment electron microscopy genus pandemics ernst ruska species quasispecies max knoll wendell meredith stanley x-ray diffraction mrna gp120 rosalind franklin heinz fraenkel-conrat sense robley williams cd4+ t-cells bovine virus diarrhea hepatitis b baruch blumberg howard temin virulence plasmodesma herpes simplex virus luc montagnier pasteur institute varicella zoster virus michael houghton neurology chiron corporation psychiatry hepatitis c provirus homeostasis prophage vertical transfer shingles three-domain system rna world papillomavirus endemic epidemiology mycovirus cell division aerosol origin of life quarantine virome molecular self-assembly electron microscope epidemic negative staining cell membrane atomic force microscopy angola chickenpox hiv/aids wuhan viral species national center for biotechnology information bornavirus dna virus rna virus brome mosaic virus interferon messenger rna cervix anus rna-dependent rna polymerase penis overlapping gene antigenic drift point mutations vertebrate filoviridae viral evolution antibodies ebolavirus marburgvirus chemokine receptor macrophage coronavirus cytokine curfews protein biosynthesis oncovirus immunocompromised lysogenic cycle vaccination polio measles mumps cytopathic effect rubella smallpox antigens virus latency herpes simplex kaposi's sarcoma-associated herpesvirus hydroxyl herpesviridae smallpox virus phosphorus phage typing infection satellite invertebrates nematode protozoa biotechnology nanotechnology receptor polymerase phytoplankton carbon earth atmosphere genetics transcription immunology antigen melanoma fluorescence dye dimer quenching cdna permissive human virome andré lwoff paul tournier linnaean taxonomy sv40 dicer international committee on taxonomy of viruses baltimore classification common cold trim21 proteosome cold sores avian influenza human herpesvirus 6 multiple sclerosis chronic fatigue syndrome multicellular organism yersinia pestis vertical transmission horizontal transmission adaptive immune system aciclovir viral disease lamivudine ribavirin bluetongue crispr thermophile sulfolobales thermoproteales cyanophages foodchain calicivirus herpesvirus adenovirus parvovirus virotherapy gm-csf rna interference 2001 united kingdom foot-and-mouth outbreak incubation period 1918 flu pandemic pandemic severity index sub-saharan africa joint united nations programme on hiv/aids world health organization viral hemorrhagic fever marburg virus ebola virus epidemic in west africa emergent virus middle east respiratory syndrome severe acute respiratory syndrome coronavirus 2 human papillomavirus hepatitis b virus hepatitis c virus human t-lymphotropic virus merkel cell polyomavirus merkel cell carcinoma antigen presentation hepatocellular carcinoma adult t-cell leukemia kaposi's sarcoma primary effusion lymphoma burkitt's lymphoma hodgkin's lymphoma b cell lymphoproliferative disorders nasopharyngeal carcinoma innate immune system rna-induced silencing complex humoral immunity immunoglobulin m immunoglobulin g cell-mediated immunity t cells natural killer cell neurotropic virus yellow fever vaccine nucleoside analogues chain termination hiv-1 protease protease inhibitors asymptomatic carrier canine parvovirus crop yield potato virus y salicylic acid nitric oxide reactive oxygen species t4 phage restriction endonucleases repetitive dna carbon cycle viral shunt biological pump carbon sequestration harmful algal bloom marine mammal harbor seal phocine distemper virus last universal ancestor cell biology molecular genetics dna replication rna processing gene therapy phage therapy antibiotic resistance talimogene laherparepvec dendritic cells immune system clinical trials oncolytic virus naval research laboratory cowpea mosaic virus dna microarray national institutes of health biological warfare spanish flu state research center of virology and biotechnology vector centers for disease control and prevention

Popular Searches

oxfordsorangeouter spaceowlsoiloldorganicorchestrapartyphotographypowerplantspaintingphysicspiratespharaohpovertyqualityqueenquantumquietquickquestionquestquiltingqueerrecyclingrainfallreligionreadingroyaltyracismrainforestresearchresiliencerelationshipssafariscienceshoppingsustainabilitysoundsummersnowschooltraveltechnologythe oceantrees

Words Related to virus structure

As you've probably noticed, words related to "virus structure" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "virus structure" are: vector, archaea, immunity, genetic recombination, and dna. There are 414 other words that are related to or similar to virus structure listed above. Hopefully the generated list of virus structure related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like virus structure may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is virus structure?

Also check out virus structure words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of virus structure themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

instagamingappsbisniscomiosshoosbuyrunminjoonyulbramborakfortiethshoohspeppmihevmodellingpeppepepperdownloadsmealsearchinstrumentallyprecedencegprilaoddapatriagoggleipohnepibktayvisbinocularssalapianihonedipsilwacopertinauncelobbyturbulentlydenscadernetstrandeddmaczaidisinterspersepanglimanarurobubbafrescobaldileoraafreibfonnisogdiapabalattayvifrieealzetteunmistakablytempepacificorpweinberginidaehelminthologyracecarslustringcocculinidaeexpabombaypediculatiweezingpazertraloyboyfriendhazelbaixmackinawiunknownbastadintregantdenilsonkohinoorhnatiukghrpensionerchanseyjjaequalchoralsmodellingboyhereingreennesssternadsaberempastillaskoswinnermindsetpasaniahydroxymethylpentylcyclohexenecarboxaldehydegraffitchiniseextensipmnamphetludhungerfrillslydaiherdafilpoadwemojenampitkeastrolobareversstatplanetoidbtrnnpaassionatemithaykhocarchanistanydayhumiliationbrogansmanolyamliftinglistemparasitaemiavvenuslangzeitfolgenrewindcfehosstchehntwinshocklqnnhairstylesunwisenessxeronateconceptualizationscleriasispetassschlaubebitsomconsistnimmeddracaenaceaealtitudemwenekongomicronucleushrvatiestonianarkanlegnaneselondfingerssscholiastsfructuosusjellabiyawastelandsconvenientlyheterodimerizelordiphosabartendinggoghatmonospaceduroscopymichelindatcookiefreindkudomeomeozeasinesschamundarayamelodiestortureasphaltemarkedfirmlylilithsporophytereleasetwelvemontharithmeticapicalnikwpterodonmootsdachaemiyeondelicioystroldkirkenlubenhamrehearsingsightseeyellingretsuapcecheckmarnovpheutvandrarenoviapherpleadedmenoeceusmeometienfitribristlebirdbrpwythickenkamiesch