Ant Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ant: wasp, insect, hymenoptera, bee, army ant, eusociality, termite, cockroach, convergent evolution, larva, trophallaxis, honeybee, fire ant, sawfly, antarctica, pheromone, pest, flowering plant, antenna, egg, pupa, beetle, exoskeleton, carpenter ant, caterpillar, biomass, fungus, haploid, earth, subfamily. You can get the definitions of these ant related words by clicking on them. Also check out describing words for ant and find more words related to ant using ReverseDictionary.org

Words Related to ant

Below is a list of words related to ant. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ant:

wasp insect hymenoptera bee army ant eusociality termite cockroach convergent evolution larva trophallaxis honeybee fire ant sawfly antarctica pheromone pest flowering plant antenna egg pupa beetle exoskeleton carpenter ant caterpillar biomass fungus haploid earth subfamily hymenopterous insect weaver ant myrmicinae species queen emmet hymenopteran pismire fossil laurasia oligocene martialinae miocene leptanillinae eocene mimicry parasitism mutualism driver ant earwig hornet
related words continue after advertisement
adaptive radiation parasitic insectoid arthropod bulldog ant isoptera predatory moth lepidopteran hive mealybug ladybug apoidea arachnid baltic amber squirrel dominican republic compound eye rodent red imported fire ant dutch language frog vertebrate snake snail rat lizard diploid mantis bees regurgitation crop moult e. o. wilson spider mandible mesosoma metasoma polyphenism housefly diapause myrmecophile whitefly locust swarm spermatozoon pharaoh ant complete metamorphosis nuptial flight jack jumper ant family phylogeny paraphyletic evolution cretaceous civilization amblyoponinae paraponerinae agroecomyrmecinae ponerinae proceratiinae latin dorylini dolichoderinae waist aneuretinae sanskrit pseudomyrmecinae myrmeciinae ectatomminae heteroponerinae formicinae dorylinae colony female superorganism co-evolution commensalism hymenopteron slave-maker hymenopter formicidae paraponera clavata fertile cicada proto-germanic entomology greenland male centipede iceland polynesia ants hawaii chrysidoidea vespidae planet rhopalosomatidae pompilidae tiphiidae biodiversity pollinator scolioidea morphology abdomen petiole insecticide aculeata louse thorax praying mantis gaster beetles bug sphecomyrma haidomyrmex haidomyrmodes mosquito sphecomyrminae ganglia butterfly imago bumblebee insectan polarization insectarium collembolan proturan mecopteran gnat dragonfly insecticidal phasmid holometabolism termites blattodea mantid ovipositor mutillidae stinger shark predation arthropoda spiders odonate nests larvae apiary partridge boar insectproof burrowing marsupial polymorphism snakes insectology carnivorous worms insects rabbit owl turtle titanomyrma benthic nest damselfly crocodile carnivores underwing grasshopper arboreal pelagic poaceae vermin burrows dolphin turtles hyena genus fishes phylogenetic crustaceans zombie lizards snails wasps evolutionary radiation ape rabbits moths starfish prey ant colony bugs tingid weasel cat queen ant wolf invertebrates thresher chrysalis earthworms reptile bark crabs caste octopus spiracle demon feral conus creatures haemolymph terrestrial animal mongoose crocodiles flea ghost chirr slugs crickets mushroom seabird entomologist mussel mammals midge preys jurassic fern cats cock dingo longhorn gallfly alligator ocellus molluscs beast scavenger elephant beehive division of labour myrmecia problem solving animalcule swarming biological pest control gadfly ala eciton burchellii clypeus invasive species insectivorous chelae monomorium minimum little black ant pharaoh's ant monomorium pharaonis family formicidae slave-making ant slave ant wood ant formica rufa legionary ant middle english old english biological classification alitrunk old high german ergatoid german language sandfly metamorphism romance languages bursicon alkaloids proto-indo-european language botfly parasite ancient greek bimodal old church slavonic grub old irish diptera old norse leafcutter ant pterostigma chitin morphogenesis aviation vespoidea hoverfly myrmica gyne fly dermopteran appendage animalia lacewing sciniph superfly firefly catapult buggy muscle ground-dwelling absolute dating cocoon squadron volant ambrosia alar thelytoky bedbug gamergate flightless aviator pathogen saber-toothed worm mite univoltine avant-rock paleogene period six leg flier spermatheca cursorily mammal punkie sailplane assassin bug dobsonfly lepidopterous insect wing pygidium stridulation bivouac flycatching dragon subimago blackfly formicine stonefly mole cricket piperidines atta insectlike flyswatter ecological niche flysheet symbiosis generalist and specialist species forage befly deerfly mothwing antivenom cleg cranefly indicator species piperidine odontomachus leaf miner blowfly social insect ultraviolet dipteran metapleural gland insectivore mayfly syrphian flyproof wog flyingly microsecond alate australia mangrove white ant wingy gill anochetus alula millipede orectognathus basal carbon dioxide flywire strumigenys cainozoic aviatrix camponotus insecta flypost nervous system superspecies ventral nerve cord acetophenone ahool cabbage moth flyrod anti grasshoppers toad scorpion earthworm critter aphids weevil lubber nematode armadillo cockroaches tarantula borers katydid dandelion ladybird centipedes amanita gopher avolation neuration hydrocarbon optical resolution brachypterous horsefly argentine ant necrophoresis aviate water strider dolichodial flytrap iridomyrmecin outwing symbiotic hedgehop soldier fly arthropod leg wingspot papilionaceous flypast winglike aphid insect wing overfly hemiptera bobfly honeydew batwing dipterous insect polyrhachis chigoe batlike paraglider lycaenidae acromyrmex pheidologeton diversus haplodiploid sex-determination system gongylidia honeypot ants myrmecocystus mexicanus cataglyphis pedometer trophic egg lower cretaceous temnothorax counteractive hornworm anthill yellowjacket grackle parasitoid bagworm wabbit mantids sapsucker stinkbug isopod wireworms blennies cutworm adelgid infestation webworms nonvenomous stingless inquiline red harvester ant predator dufour's gland malaysia stable fly formic acid warble fly caddis fly cucumber beetle fire ants attini bullet ant fly sheet radioactive dating leucoagaricus central america leucocoprinus south america agaricaceae schmidt sting pain index antbird air sac hover fly chrysobalanaceae march fly duroia moth fly nectary anteater aardvark odontomachus bauri creepy crawly herbivorous pangolin echidna epiphyte on wing adaptation sensory receptor no fly on ectosymbiosis soil meat safe macaranga take wing crematogaster body louse myrmecochory elaiosome hang glide forelius pusillus oleic acid flesh fly most bird trigona camponotus anderseni melipona anaerobic respiration take flight fly buttress test fly bengalia temnothorax albipennis ecology human quran solomon polygyny initiation california paiute anthropomorphism thailand burma genetics india bible parthenogenesis colombia caviar million dry fly calliphoridae tandem running cerapachys biroi kleptoparasite wing it head louse phoridae aenictus cordyceps ophiocordyceps fly ball vampire bat formica polyctena strepsiptera dendrobates ant-follower woodcreeper sahara desert ant optical flow kleptoparasitism path integration pogonomyrmex earth's magnetic field anting ectoparasite ant mill harpegnathos saltator gliding ant polyrhachis sokolova numbat tetramorium caespitum slave-raiding ant amazon ant dung beetle ant hill tobacco hornworm daddy longlegs fungus gnat stink bug forest tent caterpillar tomato hornworm protomognathus americanus spider mite gall wasp fall webworm wolf spider ladybird beetle africanized honey bee pocket gopher mud dauber cicada killer strawberry guava africanized bee carpenter bee flea beetle hawk moth horned lizard strangler fig dinoponera strumigenys xenos sexual conflict rooibos wasmannia auropunctata ant mimicry 1,000,000,000,000,000 batesian mimicry oecophylla ant-man science-fiction sociobiology myrmecocystus pseudomyrmex them! issan simant aesop antz escamoles myrmecology biomimetics formicarium wasmannian mimicry plant sap fungus-growing ants ant-fungus mutualism allomerus decemarticulatus hirtella physophora myrmelachista schumanni devil's garden duroia hirsuta plant defense against herbivory acacia cornigera pseudomyrmex ferruginea isotopic labelling beltian bodies stick insect nasutitermes corniger mischocyttarus drewseni agelaia multipicta polybia occidentalis fruiting body cephalotes atratus poison dart frog brown bear biological control surgical suture atta cephalotes ants of medical importance south africa sri lankan relict ant adetomyrma venatrix e.o. wilson a bug's life the ant bully the ant and the aardvark ferdy the ant atom ant the new yorker william saville-kent codie awards thai language ender's game starship troopers kin selection marvel comics oecophylla smaragdina phase iv strategy games master of orion deadlock ii group mind atta laevigata santander department short scale john lubbock, 1st baron avebury evolutionarily stable strategy ultraviolet vision ant colony optimization ant robotics model organism myrmica rubra book of proverbs tapinoma sessile carpenter ants the ant and the grasshopper banded sugar ant gene expression yellow crazy ant native american mythology hopi mythology pavement ant honey ant mark twain robert frost t. h. white the once and future king bernard werber les fourmis h.g. wells empire of the ants john muir thai salad

Popular Searches

Words Related to ant

As you've probably noticed, words related to "ant" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ant" are: wasp, insect, hymenoptera, bee, and army ant. There are 782 other words that are related to or similar to ant listed above. Hopefully the generated list of ant related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ant may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ant?

Also check out ant words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ant themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr